WDFY2 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of WDFY2 expression in transfected 293T cell line (H00115825-T01) by WDFY2 MaxPab polyclonal antibody.
Lane 1: WDFY2 transfected lysate(44 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human WDFY2 protein.
Immunogen
WDFY2 (NP_443182.1, 1 a.a. ~ 400 a.a) full-length human protein.
Sequence
MAAEIQPKPLTRKPILLQRMEGSQEVVNMAVIVPKEEGVISVSEDRTVRVWLKRDSGQYWPSVYHAMPSPCSCMSFNPETRRLSIGLDNGTISEFILSEDYNKMTPVKNYQAHQSRVTMILFVLELEWVLSTGQDKQFAWHCSESGQRLGGYRTSAVASGLQFDVETRHVFIGDHSGQVTILKLEQENCTLVTTFRGHTGGVTALCWDPVQRVLFSGSSDHSVIMWDIGGRKGTAIELQGHNDRVQALSYAQHTRQLISCGGDGGIVVWNMDVERQETPEWLDSDSCQKCDQPFFWNFKQMWDSKKIGLRQHHCRKCGKAVCGKCSSKRSSIPLMGFEFEVRVCDSCHEAITDEERAPTATFHDSKHNIVHVHFDATRGWLLTSGTDKVIKLWDMTPVVS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (98); Rat (98)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of WDFY2 expression in transfected 293T cell line (H00115825-T01) by WDFY2 MaxPab polyclonal antibody.
Lane 1: WDFY2 transfected lysate(44 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — WDFY2
Entrez GeneID
115825GeneBank Accession#
NM_052950Protein Accession#
NP_443182.1Gene Name
WDFY2
Gene Alias
PROF, RP11-147H23.1, WDF2, ZFYVE22
Gene Description
WD repeat and FYVE domain containing 2
Omim ID
610418Gene Ontology
HyperlinkGene Summary
This gene encodes a protein that contains two WD domains and an FYVE zinc finger region. The function of this gene is unknown. An alternatively spliced transcript variant of this gene may exist. [provided by RefSeq
Other Designations
OTTHUMP00000018795|WD40 and FYVE domain containing 2|propeller-FYVE protein
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com