DHRS1 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
DHRS1 MaxPab polyclonal antibody. Western Blot analysis of DHRS1 expression in human liver.
Western Blot (Transfected lysate)
Western Blot analysis of DHRS1 expression in transfected 293T cell line (H00115817-T01) by DHRS1 MaxPab polyclonal antibody.
Lane 1: DHRS1 transfected lysate(34.43 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human DHRS1 protein.
Immunogen
DHRS1 (NP_612461.1, 1 a.a. ~ 313 a.a) full-length human protein.
Sequence
MAAPMNGQVCVVTGASRGIGRGIALQLCKAGATVYITGRHLDTLRVVAQEAQSLGGQCVPVVCDSSQESEVRSLFEQVDREQQGRLDVLVNNAYAGVQTILNTRNKAFWETPASMWDDINNVGLRGHYFCSVYGARLMVPAGQGLIVVISSPGSLQYMFNVPYGVGKAACDKLAADCAHELRRHGVSCVSLWPGIVQTELLKEHMAKEEVLQDPVLKQFKSAFSSAETTELSGKCVVALATDPNILSLSGKVLPSCDLARRYGLRDVDGRPVQDYLSLSSVLSHVSGLGWLASYLPSFLRVPKWIIALYTSKF
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (82); Rat (84)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
DHRS1 MaxPab polyclonal antibody. Western Blot analysis of DHRS1 expression in human liver.Western Blot (Transfected lysate)
Western Blot analysis of DHRS1 expression in transfected 293T cell line (H00115817-T01) by DHRS1 MaxPab polyclonal antibody.
Lane 1: DHRS1 transfected lysate(34.43 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — DHRS1
Entrez GeneID
115817GeneBank Accession#
NM_138452.1Protein Accession#
NP_612461.1Gene Name
DHRS1
Gene Alias
DKFZp586I0523, FLJ14250, FLJ25430, MGC20204, SDR19C1
Gene Description
dehydrogenase/reductase (SDR family) member 1
Omim ID
610410Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the short-chain dehydrogenases/reductases (SDR) family. The encoded enzyme contains a conserved catalytic domain and likely functions as an oxidoreductase. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq
Other Designations
OTTHUMP00000164786|short chain dehydrogenase/reductase family 19C, member 1
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com