Product Browser

Last updated: 2017/9/24
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ARL11 MaxPab rabbit polyclonal antibody (D01)MaxPab

  • Catalog # : H00115761-D01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human ARL11 protein.
  • Immunogen:
  • ARL11 (NP_612459.1, 1 a.a. ~ 196 a.a) full-length human protein.
  • Sequence:
  • MGSVNSRGHKAEAQVVMMGLDSAGKTTLLYKLKGHQLVETLPTVGFNVEPLKAPGHVSLTLWDVGGQAPLRASWKDYLEGTDILVYVLDSTDEARLPESAAELTEVLNDPNMAGVPFLVLANKQEAPDALPLLKIRNRLSLERFQDHCWELRGCSALTGEGLPEALQSLWSLLKSRSCMCLQARAHGAERGDSKRS
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • ARL11 MaxPab rabbit polyclonal antibody. Western Blot analysis of ARL11 expression in human kidney.
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of ARL11 expression in transfected 293T cell line (H00115761-T01) by ARL11 MaxPab polyclonal antibody.

    Lane 1: ARL11 transfected lysate(21.4 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Immunoprecipitation
  • Immunoprecipitation
  • Immunoprecipitation of ARL11 transfected lysate using anti-ARL11 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with ARL11 purified MaxPab mouse polyclonal antibody (B01P) (H00115761-B01P).
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • ARL11
  • Gene Alias:
  • ARLTS1,FLJ33930,MGC17429
  • Gene Description:
  • ADP-ribosylation factor-like 11
  • Other Designations:
  • ADP-ribosylation factor-like tumor suppressor protein 1,OTTHUMP00000018420
  • RSS
  • YouTube
  • Linkedin
  • Facebook