Product Browser

Last updated: 2017/7/23
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

UHRF2 monoclonal antibody (M01), clone 3A11

  • Catalog # : H00115426-M01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant UHRF2.
  • Immunogen:
  • UHRF2 (NP_690856, 81 a.a. ~ 180 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • PGTSTQIEAKPCSNSPPKVKKAPRVGPSNQPSTSARARLIDPGFGIYKVNELVDARDVGLGAWFEAHIHSVTRASDGQSRGKTPLKNGSSCKRTNGNIKH
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2b Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00115426-M01
    Western Blot detection against Immunogen (36.74 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of UHRF2 expression in transfected 293T cell line by UHRF2 monoclonal antibody (M01), clone 3A11.

    Lane 1: UHRF2 transfected lysate(56.1 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • ELISA
  • RNAi Knockdown (Antibody validated)
  • RNAi Knockdown (Antibody validated)
  • Western blot analysis of UHRF2 over-expressed 293 cell line, cotransfected with UHRF2 Validated Chimera RNAi ( Cat # H00115426-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with UHRF2 monoclonal antibody (M01), clone 3A11 (Cat # H00115426-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • RNAi Knockdown (Antibody validated)
  • RNAi Knockdown (Antibody validated)
  • enlarge
  • Gene Information
  • Gene Name:
  • UHRF2
  • Gene Alias:
  • DKFZp434B0920,DKFZp686G0837,MGC33463,NIRF,RNF107,URF2
  • Gene Description:
  • ubiquitin-like with PHD and ring finger domains 2
  • Gene Summary:
  • This gene encodes a nuclear protein which is involved in cell-cycle regulation. The encoded protein is a ubiquitin-ligase capable of ubiquinating PCNP (PEST-containing nuclear protein), and together they may play a role in tumorigenesis. [provided by RefSeq
  • Other Designations:
  • Np95-like ring finger protein,OTTHUMP00000021047,OTTHUMP00000044452,nuclear zinc finger protein NP97,ubiquitin-like, containing PHD and RING finger domains, 2
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook