UHRF2 monoclonal antibody (M01), clone 3A11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of UHRF2 expression in transfected 293T cell line by UHRF2 monoclonal antibody (M01), clone 3A11.
Lane 1: UHRF2 transfected lysate(56.1 KDa).
Lane 2: Non-transfected lysate.
RNAi Knockdown (Antibody validated)
Western blot analysis of UHRF2 over-expressed 293 cell line, cotransfected with UHRF2 Validated Chimera RNAi ( Cat # H00115426-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with UHRF2 monoclonal antibody (M01), clone 3A11 (Cat # H00115426-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Immunofluorescence
Immunofluorescence of monoclonal antibody to UHRF2 on HeLa cell . [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant UHRF2.
Immunogen
UHRF2 (NP_690856, 81 a.a. ~ 180 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
PGTSTQIEAKPCSNSPPKVKKAPRVGPSNQPSTSARARLIDPGFGIYKVNELVDARDVGLGAWFEAHIHSVTRASDGQSRGKTPLKNGSSCKRTNGNIKH
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (88); Rat (87)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of UHRF2 expression in transfected 293T cell line by UHRF2 monoclonal antibody (M01), clone 3A11.
Lane 1: UHRF2 transfected lysate(56.1 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of UHRF2 over-expressed 293 cell line, cotransfected with UHRF2 Validated Chimera RNAi ( Cat # H00115426-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with UHRF2 monoclonal antibody (M01), clone 3A11 (Cat # H00115426-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.Immunofluorescence
Immunofluorescence of monoclonal antibody to UHRF2 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — UHRF2
Entrez GeneID
115426GeneBank Accession#
NM_152896Protein Accession#
NP_690856Gene Name
UHRF2
Gene Alias
DKFZp434B0920, DKFZp686G0837, MGC33463, NIRF, RNF107, URF2
Gene Description
ubiquitin-like with PHD and ring finger domains 2
Gene Ontology
HyperlinkGene Summary
This gene encodes a nuclear protein which is involved in cell-cycle regulation. The encoded protein is a ubiquitin-ligase capable of ubiquinating PCNP (PEST-containing nuclear protein), and together they may play a role in tumorigenesis. [provided by RefSeq
Other Designations
Np95-like ring finger protein|OTTHUMP00000021047|OTTHUMP00000044452|nuclear zinc finger protein NP97|ubiquitin-like, containing PHD and RING finger domains, 2
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com