FCRL1 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human FCRL1 partial ORF ( NP_443170, 23 a.a. - 117 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
ASPSHPTEGSPVTLTCKMPFLQSSDAQFQFCFFRDTRALGPGWSSSPKLQIAAMWKEDTGSYWCEAQTMASKVLRSRRSQINVHRVPVADVSLET
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.19
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — FCRL1
Entrez GeneID
115350GeneBank Accession#
NM_052938Protein Accession#
NP_443170Gene Name
FCRL1
Gene Alias
DKFZp667O1421, FCRH1, IFGP1, IRTA5, RP11-367J7.7
Gene Description
Fc receptor-like 1
Omim ID
606508Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the immunoglobulin receptor superfamily and is one of several Fc receptor-like glycoproteins clustered on the long arm of chromosome 1. The encoded protein contains three extracellular C2-like immunoglobulin domains, a transmembrane domain and a cytoplasmic domain with two immunoreceptor-tyrosine activation motifs. This protein may play a role in the regulation of cancer cell growth. Alternative splicing results in multiple transcript variants. [provided by RefSeq
Other Designations
Fc receptor-like protein 1 (FCRH1)|OTTHUMP00000020924
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com