Product Browser

Last updated: 2017/4/30

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

FCRL1 polyclonal antibody (A01)

  • Catalog # : H00115350-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant FCRL1.
  • Immunogen:
  • FCRL1 (NP_443170, 23 a.a. ~ 117 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • ASPSHPTEGSPVTLTCKMPFLQSSDAQFQFCFFRDTRALGPGWSSSPKLQIAAMWKEDTGSYWCEAQTMASKVLRSRRSQINVHRVPVADVSLET
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00115350-A01
    Western Blot detection against Immunogen (36.56 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • FCRL1 polyclonal antibody (A01), Lot # 060614JCS1 Western Blot analysis of FCRL1 expression in SJCRH30 ( Cat # L027V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • FCRL1
  • Gene Alias:
  • DKFZp667O1421,FCRH1,IFGP1,IRTA5,RP11-367J7.7
  • Gene Description:
  • Fc receptor-like 1
  • Gene Summary:
  • This gene encodes a member of the immunoglobulin receptor superfamily and is one of several Fc receptor-like glycoproteins clustered on the long arm of chromosome 1. The encoded protein contains three extracellular C2-like immunoglobulin domains, a transmembrane domain and a cytoplasmic domain with two immunoreceptor-tyrosine activation motifs. This protein may play a role in the regulation of cancer cell growth. Alternative splicing results in multiple transcript variants. [provided by RefSeq
  • Other Designations:
  • Fc receptor-like protein 1 (FCRH1),OTTHUMP00000020924
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook