SLC26A9 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
SLC26A9 polyclonal antibody (A01), Lot # 060717JCS1. Western Blot analysis of SLC26A9 expression in Daoy.
Western Blot detection against Immunogen (38.21 KDa) .
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant SLC26A9.
Immunogen
SLC26A9 (NP_443166, 496 a.a. ~ 605 a.a) partial recombinant protein with GST tag.
Sequence
QTQFRNGYALAQVMDTDIYVNPKTYNRAQDIQGIKIITYCSPLYFANSEIFRQKVIAKTGMDPQKVLLAKQKYLKKQEKRRMRPTQQRRSLFMKTKTVSLQELQQDFENA
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (89); Rat (88)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (38.21 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
SLC26A9 polyclonal antibody (A01), Lot # 060717JCS1. Western Blot analysis of SLC26A9 expression in Daoy.Western Blot (Recombinant protein)
ELISA
-
Gene Info — SLC26A9
Entrez GeneID
115019GeneBank Accession#
NM_052934Protein Accession#
NP_443166Gene Name
SLC26A9
Gene Alias
-
Gene Description
solute carrier family 26, member 9
Omim ID
608481Gene Ontology
HyperlinkGene Summary
This gene is one member of a family of sulfate/anion transporter genes. Family members are well conserved in their genomic (number and size of exons) and protein (aa length among species) structures yet have markedly different tissue expression patterns. The product of this gene is a highly selective chloride ion channel regulated by WNK kinases. Alternative splicing results in multiple transcript variants encoding differing isoforms
Other Designations
OTTHUMP00000034236|OTTHUMP00000034326|anion transporter/exchanger-9
-
Disease
-
Publication Reference
-
The SLC26A9 inhibitor S9-A13 provides no evidence for a role of SLC26A9 in airway chloride secretion but suggests a contribution to regulation of ASL pH and gastric proton secretion.
Sungwoo Jo, Raquel Centeio, Jinhong Park, Jiraporn Ousingsawat, Dong-Kyu Jeon, Khaoula Talbi, Rainer Schreiber, Kunhi Ryu, Kristin Kahlenberg, Veronika Somoza, Livia Delpiano, Michael A Gray, Margarida D Amaral, Violeta Railean, Jeffrey M Beekman, Lisa W Rodenburg, Wan Namkung, Karl Kunzelmann.
FASEB Journal 2022 Nov; 36(11):e22534.
Application：WB-Ce, Human, LN215 cells.
-
Nedd4-2 does not regulate wt-CFTR in human airway epithelial cells.
Koeppen K, Chapline C, Sato JD, Stanton BA.
American Journal of Physiology. Lung Cellular and Molecular Physiology 2012 Oct; 303(8):L720.
Application：WB-Tr, Human, Human airway epithelial cells.
-
The SLC26A9 inhibitor S9-A13 provides no evidence for a role of SLC26A9 in airway chloride secretion but suggests a contribution to regulation of ASL pH and gastric proton secretion.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com