OSBPL5 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human OSBPL5 partial ORF ( NP_663613, 4 a.a. - 99 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
EAFLRRRFSLCPPSSTPQKVDPRKLTRNLLLSGDNELYPLSPGKDMEPNGPSLPRDEGPPTPSSATKVPPAEYRLCNGSDKECVSPTARVTKKETL
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.3
Interspecies Antigen Sequence
Mouse (84); Rat (84)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — OSBPL5
Entrez GeneID
114879GeneBank Accession#
NM_145638Protein Accession#
NP_663613Gene Name
OSBPL5
Gene Alias
FLJ42929, OBPH1, ORP5
Gene Description
oxysterol binding protein-like 5
Omim ID
606733Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the oxysterol-binding protein (OSBP) family, a group of intracellular lipid receptors. Most members contain an N-terminal pleckstrin homology domain and a highly conserved C-terminal OSBP-like sterol-binding domain. Transcript variants encoding different isoforms have been identified. [provided by RefSeq
Other Designations
OSBP-related protein 5|OTTHUMP00000013404|OTTHUMP00000013405|oxysterol-binding protein homologue 1|oxysterol-binding protein-like protein 5|oxysterol-binding protein-related protein 5
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com