Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

OSBPL1A (Human) Recombinant Protein (Q01)

  • Catalog # : H00114876-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human OSBPL1A partial ORF ( NP_542164.2, 268 a.a. - 340 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • KQPDAVHNIYRQGCKHLTQAVCTVKSTDSCLFFIKCFDDTIHGFRVPKNSLQQSREDWLEAIEEHSAYSTHYC
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 33.77
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00114876-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • OSBPL1A
  • Gene Alias:
  • FLJ10217,ORP-1,ORP1,OSBPL1B
  • Gene Description:
  • oxysterol binding protein-like 1A
  • Gene Summary:
  • This gene encodes a member of the oxysterol-binding protein (OSBP) family, a group of intracellular lipid receptors. Most members contain an N-terminal pleckstrin homology domain and a highly conserved C-terminal OSBP-like sterol-binding domain, although some members contain only the sterol-binding domain. Transcript variants derived from alternative promoter usage and/or alternative splicing exist; they encode different isoforms. [provided by RefSeq
  • Other Designations:
  • OSBP-related protein 1,oxysterol binding protein-like 1B,oxysterol-binding protein-like 1A,oxysterol-binding protein-related protein 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook