GNRHR2 monoclonal antibody (M01), clone 4A5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant GNRHR2.
Immunogen
GNRHR2 (NP_001457, 237 a.a. ~ 292 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
TLGCRRGHQELSIDSSKEGSGRMLQEEIHAFRQLEVQKTVTSRRAGETKGISITSI
Host
Mouse
Reactivity
Human, Mouse
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (31.9 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
GNRHR2 monoclonal antibody (M01), clone 4A5 Western Blot analysis of GNRHR2 expression in HeLa ( Cat # L013V1 ).Western Blot (Cell lysate)
GNRHR2 monoclonal antibody (M01), clone 4A5. Western Blot analysis of GNRHR2 expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Cell lysate)
GNRHR2 monoclonal antibody (M01), clone 4A5. Western Blot analysis of GNRHR2 expression in Raw 264.7(Cat # L024V1 ).Western Blot (Cell lysate)
GNRHR2 monoclonal antibody (M01), clone 4A5. Western Blot analysis of GNRHR2 expression in HepG2 ( Cat # L019V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged GNRHR2 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — GNRHR2
Entrez GeneID
114814GeneBank Accession#
NM_057163Protein Accession#
NP_001457Gene Name
GNRHR2
Gene Alias
GnRH-II-R
Gene Description
gonadotropin-releasing hormone (type 2) receptor 2
Gene Ontology
HyperlinkGene Summary
The receptor for gonadotropin releasing hormone 2 (GnRH2) is encoded by the GnRH2 receptor (GnRHR2) gene. In non-hominoid primates and non-mammalian vertebrates, GnRHR2 encodes a seven-transmembrane G-protein coupled receptor. However, in human, the N-terminus of the predicted protein contains a frameshift and premature stop codon. In human, GnRHR2 transcription occurs but whether the gene produces a functional C-terminal multi-transmembrane protein is currently unresolved. Alternative splice variants have been reported. An untranscribed pseudogene of GnRHR2 is also on chromosome 14. [provided by RefSeq
Other Designations
-
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com