Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ESCO1 purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00114799-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human ESCO1 protein.
  • Immunogen:
  • ESCO1 (AAH36943.1, 1 a.a. ~ 172 a.a) full-length human protein.
  • Sequence:
  • MVLPEDPKYALKKVDEIREMVDNDLGFQQAPLMCYSRTKTLLFISNDKKVVGCLIAEHIQWGYRVIEEKLPVIRSEEEKVRFERQKAWCCSTLPEPAICGISRIWVFSMMRRKKIASRMIECLRSNFIYGSYLSKEEIAFSDPTPDGKLFATQYCGTGQFLVYNFINGQNST
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of ESCO1 expression in transfected 293T cell line (H00114799-T01) by ESCO1 MaxPab polyclonal antibody.

    Lane 1: ESCO1 transfected lysate(18.92 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • ESCO1
  • Gene Alias:
  • A930014I12Rik,CTF,ECO1,EFO1,ESO1,KIAA1911,MGC105022
  • Gene Description:
  • establishment of cohesion 1 homolog 1 (S. cerevisiae)
  • Gene Summary:
  • ESCO1 belongs to a conserved family of acetyltransferases involved in sister chromatid cohesion (Hou and Zou, 2005 [PubMed 15958495]).[supplied by OMIM
  • Other Designations:
  • establishment factor-like protein,establishment of cohesion 1 homolog 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook