FMNL2 monoclonal antibody (M01), clone 2B4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant FMNL2.
Immunogen
FMNL2 (AAH36492, 1 a.a. ~ 178 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MDLTKREYTMHDHNTLLKEFILNNEGKLKKLQDDAKIAQDAFDDVVKYFGENPKTTPPSVFFPVFVRFVKAYKQAEEENELRKKQEQALMEKLLEQEALMEQQDPKSPSHKSKRQQQELIAELRRRQVKDNRHVYEGKDGAIEDIITALKKNNITKFPNVHSRVRISSSTPVVEDTQS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (94)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (45.32 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
FMNL2 monoclonal antibody (M01), clone 2B4 Western Blot analysis of FMNL2 expression in IMR-32 ( Cat # L008V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged FMNL2 is 0.1 ng/ml as a capture antibody.ELISA
-
Gene Info — FMNL2
Entrez GeneID
114793GeneBank Accession#
BC036492Protein Accession#
AAH36492Gene Name
FMNL2
Gene Alias
FHOD2, FLJ37546
Gene Description
formin-like 2
Gene Ontology
HyperlinkGene Summary
This gene encodes a formin-related protein. Formin-related proteins have been implicated in morphogenesis, cytokinesis, and cell polarity. Alternatively spliced transcript variants encoding different isoforms have been described but their full-length nature has yet to be determined. [provided by RefSeq
Other Designations
formin homology 2 domain containing 2
-
Interactome
-
Disease
-
Publication Reference
-
Epigenetic silencing of miR137 in gastric cancer.
Jin W, Jiang T, Sun J, Xu W, Feng L, Jin H, Wang X.
Molecular Carcinogenesis 2015 Feb; 55(4):376.
Application:WB, Human, AGS, NCI-N87 cells.
-
Down-regulation of formin-like 2 predicts poor prognosis in hepatocellular carcinoma.
Liang L, Guan J, Zeng Y, Wang J, Li X, Zhang X, Ding Y.
Human Pathology 2011 Nov; 42(11):1603.
Application:IHC, WB, Human, HepG2, M6, Huh7, QGy-7703, HL-7702 cells, Hepatocellular carcinoma.
-
FMNL2 is a positive regulator of cell motility and metastasis in colorectal carcinoma.
Zhu XL, Zeng YF, Guan J, Li YF, Deng YJ, Bian XW, Ding YQ, Liang L.
The Journal of Pathology 2011 Jul; 224(3):377.
Application:WB-Ce, Human, CRC cell lines SW620, SW480, HT29.
-
FMNL2 enhances invasion of colorectal carcinoma by inducing epithelial mesenchymal transition.
Li Y, Zhu X, Zeng Y, Wang J, Zhang X, Ding YQ, Liang L.
Molecular Cancer Research 2010 Dec; 8(12):1579.
Application:IHC-P, WB-Ce, WB-Tr, Human, SW620, SW480/M5, SW480, HT29 cells, Colorectal carcinoma.
-
Formin-like 2 drives amoeboid invasive cell motility downstream of RhoC.
Kitzing TM, Wang Y, Pertz O, Copeland JW, Grosse R.
Oncogene 2010 Apr; 29(16):2441.
Application:WB-Tr, Mouse, MEFs.
-
Overexpression of FMNL2 is closely related to metastasis of colorectal cancer.
Zhu XL, Liang L, Ding YQ.
International Journal of Colorectal Disease 2008 Jul; 23(11):1041.
Application:IHC-P, WB-Ce, Human, Colorectal cancer (CRC) and adjacent normal colorectal mucosa, HT29, LoVo, LS174T, SW480, SW620 cells.
-
Epigenetic silencing of miR137 in gastric cancer.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com