Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SLC25A25 monoclonal antibody (M02), clone 4D8

  • Catalog # : H00114789-M02
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant SLC25A25.
  • Immunogen:
  • SLC25A25 (NP_443133, 2 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • LCLCLYVPVIGEAQTEFQYFESKGLPAELKSIFKLSVFIPSQEFSTYRQWKQKIVQAGDKDLDGQLDFEEFVHYLQDHEKKLRLVFKSLDKKNDGRIDAQEIMQSLRDL
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00114789-M02
    Western Blot detection against Immunogen (37.73 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of SLC25A25 expression in transfected 293T cell line by SLC25A25 monoclonal antibody (M02), clone 4D8.

    Lane 1: SLC25A25 transfected lysate(52.7 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged SLC25A25 is 0.3 ng/ml as a capture antibody.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • enlarge
  • ELISA
  • Gene Information
  • Gene Name:
  • SLC25A25
  • Gene Alias:
  • KIAA1896,MCSC,MGC105138,MGC119514,MGC119515,MGC119516,MGC119517,PCSCL,RP11-395P17.4,SCAMC-2
  • Gene Description:
  • solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 25
  • Other Designations:
  • OTTHUMP00000022250,mitochondrial ATP-Mg/Pi carrier,mitochondrial Ca2+-dependent solute carrier,short calcium-binding mitochondrial carrier 2,small calcium-binding mitochondrial carrier 2,solute carrier family 25, member 25,solute carrier family 25, member
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook