LMTK3 monoclonal antibody (M02), clone 2H6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant LMTK3.
Immunogen
LMTK3 (XP_055866, 1151 a.a. ~ 1250 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
VLVNGGLTPPKSEDKVSENGGLRFPRNTERPPETGPWRAPGPWEKTPESWGPAPTIGEPAPETSLERAPAPSAVVSSRNGGETAPGPLGPAPKNGTLEPG
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (63)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
LMTK3 monoclonal antibody (M02), clone 2H6 Western Blot analysis of LMTK3 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged LMTK3 is 0.03 ng/ml as a capture antibody.ELISA
-
Gene Info — LMTK3
-
Interactome
-
Publication Reference
-
LMTK3 confers chemo-resistance in breast cancer.
Stebbing J, Shah K, Lit LC, Gagliano T, Ditsiou A, Wang T, Wendler F, Simon T, Szabó KS, O'Hanlon T, Dean M, Roslani AC, Cheah SH, Lee SC, Giamas G.
Oncogene 2018 Jun; 37(23):3113.
Application:IF, IHC, WB-Tr, Human, MCF-7 cells.
-
LMTK3 Represses Tumor Suppressor-like Genes through Chromatin Remodeling in Breast Cancer.
Yichen Xu, Hua Zhang, Van Thuy Mai Nguyen, Nicos Angelopoulos, Joao Nunes, Alistair Reid, Laki Buluwela, Luca Magnani, Justin Stebbing, Georgios Giamas.
Cell Reports 2015 Aug; 12(5):837.
Application:ChIP, IF, IP-WB, WB, WB-Tr, Human, MCF-7, MDA-MB-231 cells.
-
LMTK3 confers chemo-resistance in breast cancer.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com