Product Browser

Last updated: 2022/10/2
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

LMTK3 monoclonal antibody (M02), clone 2H6 

  • Catalog # : H00114783-M02
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant LMTK3.
  • Immunogen:
  • LMTK3 (XP_055866, 1151 a.a. ~ 1250 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • VLVNGGLTPPKSEDKVSENGGLRFPRNTERPPETGPWRAPGPWEKTPESWGPAPTIGEPAPETSLERAPAPSAVVSSRNGGETAPGPLGPAPKNGTLEPG
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG1 Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00114783-M02
    Western Blot detection against Immunogen (36.63 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Interspecies Antigen Sequence:
  • Mouse (63)
  • Publication Reference
  • 1.
  • LMTK3 confers chemo-resistance in breast cancer.
    Stebbing J, Shah K, Lit LC, Gagliano T, Ditsiou A, Wang T, Wendler F, Simon T, Szabó KS, OHanlon T, Dean M, Roslani AC, Cheah SH, Lee SC, Giamas G.Oncogene. 2018 Jun;37(23):3113-3130. doi: 10.1038/s41388-018-0197-0. Epub 2018 Mar 15.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • LMTK3 monoclonal antibody (M02), clone 2H6 Western Blot analysis of LMTK3 expression in Hela S3 NE ( Cat # L013V3 ).
  • PDF DownloadProtocol Download
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged LMTK3 is 0.03 ng/ml as a capture antibody.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • enlarge
  • ELISA
  • Gene Information
  • Gene Name:
  • LMTK3
  • Gene Alias:
  • KIAA1883,LMR3,TYKLM3
  • Gene Description:
  • lemur tyrosine kinase 3
  • Other Designations:
  • -
  • RSS
  • YouTube
  • Linkedin
  • Facebook