LMTK3 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
LMTK3 polyclonal antibody (A01), Lot # 060525JCS1. Western Blot analysis of LMTK3 expression in Raw 264.7.
Western Blot (Cell lysate)
LMTK3 polyclonal antibody (A01), Lot # 060525JCS1 Western Blot analysis of LMTK3 expression in Hela S3 NE ( Cat # L013V3 ).
Western Blot (Cell lysate)
LMTK3 polyclonal antibody (A01), Lot # 060525JCS1. Western Blot analysis of LMTK3 expression in NIH/3T3.
Western Blot detection against Immunogen (37 KDa) .
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant LMTK3.
Immunogen
LMTK3 (XP_055866, 1151 a.a. ~ 1250 a.a) partial recombinant protein with GST tag.
Sequence
VLVNGGLTPPKSEDKVSENGGLRFPRNTERPPETGPWRAPGPWEKTPESWGPAPTIGEPAPETSLERAPAPSAVVSSRNGGETAPGPLGPAPKNGTLEPG
Host
Mouse
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (63)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
LMTK3 polyclonal antibody (A01), Lot # 060525JCS1. Western Blot analysis of LMTK3 expression in Raw 264.7.Western Blot (Cell lysate)
LMTK3 polyclonal antibody (A01), Lot # 060525JCS1 Western Blot analysis of LMTK3 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Cell lysate)
LMTK3 polyclonal antibody (A01), Lot # 060525JCS1. Western Blot analysis of LMTK3 expression in NIH/3T3.Western Blot (Recombinant protein)
ELISA
-
Gene Info — LMTK3
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com