CYGB monoclonal antibody (M02), clone 1A1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of CYGB expression in transfected 293T cell line by CYGB monoclonal antibody (M02), clone 1A1.
Lane 1: CYGB transfected lysate(21 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to CYGB on formalin-fixed paraffin-embedded human heart. [antibody concentration 3 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CYGB is approximately 1ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to CYGB on HeLa cell . [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (46.64 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant CYGB.
Immunogen
CYGB (AAH29798, 1 a.a. ~ 190 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MEKVPGEMEIERRERSEELSEAERKAVQAMWARLYASCEDVGVAILVRFFVNFPSAKQYFSQFKHMEDPLEMERSPQLRKHACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVEPVYFKILSGVILEVVAEEFASDFPPETQRAWAKLRGLIYSHVTAAYKEVGWVQQVPNATTPPATLPSSGP
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (94); Rat (93)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (46.64 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of CYGB expression in transfected 293T cell line by CYGB monoclonal antibody (M02), clone 1A1.
Lane 1: CYGB transfected lysate(21 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to CYGB on formalin-fixed paraffin-embedded human heart. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CYGB is approximately 1ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to CYGB on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — CYGB
Entrez GeneID
114757GeneBank Accession#
BC029798Protein Accession#
AAH29798Gene Name
CYGB
Gene Alias
HGB, STAP
Gene Description
cytoglobin
Omim ID
608759Gene Ontology
HyperlinkGene Summary
Cytoglobin is a ubiquitously expressed hexacoordinate hemoglobin that may facilitate diffusion of oxygen through tissues, scavenge nitric oxide or other reactive oxygen species, or serve a protective function during oxidative stress (Trent and Hargrove, 2002 [PubMed 11893755]).[supplied by OMIM
Other Designations
histoglobin|stellate cell activation-associated protein
-
Interactome
-
Publication Reference
-
DNA damage induced activation of Cygb stabilizes p53 and mediates G1 arrest.
John R, Chand V, Chakraborty S, Jaiswal N, Nag A.
DNA Repair 2014 Dec; 24:107.
Application：WB-Tr, Human, U-2 OS cells.
-
Cytoglobin has bimodal: tumour suppressor and oncogene functions in lung cancer cell lines.
Oleksiewicz U, Liloglou T, Tasopoulou KM, Daskoulidou N, Bryan J, Gosney JR, Field JK, Xinarianos G.
Human Molecular Genetics 2013 Aug; 22(16):3207.
Application：WB-Tr, Human, CALU1, H358 cells.
-
Pathway specific gene expression profiling reveals oxidative stress genes potentially regulated by transcription co-activator LEDGF/p75 in prostate cancer cells.
Basu A, Drame A, Munoz R, Gijsbers R, Debyser Z, De Leon M, Casiano CA.
Prostate 2012 May; 72(6):597.
Application：WB-Tr, Human, DU 145, PC-3 cells.
-
p53-mediated apoptosis, neuroglobin overexpression, and globin deposits in a patient with hereditary ferritinopathy.
Powers JM.
Journal of Neuropathology and Experimental Neurology 2006 Jul; 65(7):716.
Application：IHC-P, Human, Human putamen..
-
Hypoxia differentially regulates the expression of neuroglobin and cytoglobin in rat brain.
Li RC, Lee SK, Pouranfar F, Brittian KR, Clair HB, Row BW, Wang Y, Gozal D.
Brain Research 2006 Jun; 1096(1):173.
Application：WB-Ti, Rat, Rat cortex.
-
DNA damage induced activation of Cygb stabilizes p53 and mediates G1 arrest.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com