ERMAP MaxPab rabbit polyclonal antibody (D01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
ERMAP MaxPab rabbit polyclonal antibody. Western Blot analysis of ERMAP expression in HeLa.
Western Blot (Transfected lysate)
Western Blot analysis of ERMAP expression in transfected 293T cell line (H00114625-T01) by ERMAP MaxPab polyclonal antibody.
Lane 1: ERMAP transfected lysate(52.60 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of ERMAP transfected lysate using anti-ERMAP MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with ERMAP purified MaxPab mouse polyclonal antibody (B01P) (H00114625-B01P).
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human ERMAP protein.
Immunogen
ERMAP (NP_001017922.1, 1 a.a. ~ 475 a.a) full-length human protein.
Sequence
MEMASSAGSWLSGCLIPLVFLRLSVHVSGHAGDAGKFHVALLGGTAELLCPLSLWPGTVPKEVRWLRSPFPQRSQAVHIFRDGKDQDEDLMPEYKGRTVLVRDAQEGSVTLQILDVRLEDQGSYRCLIQVGNLSKEDTVILQVAAPSVGSLSPSAVALAVILPVLVLLIMVCLCLIWKQRRAKEKLLYEHVTEVDNLLSDHAKEKGKLHKAVKKLRSELKLKRAAANSGWRRARLHFVAVTLDPDTAHPKLILSEDQRCVRLGDRRQPVPDNPQRFDFVVSILGSEYFTTGCHYWEVYVGDKTKWILGVCSESVSRKGKVTASPANGHWLLRQSRGNEYEALTSPQTSFRLKEPPRCVGIFLDYEAGVISFYNVTNKSHIFTFTHNFSGPLRPFFEPCLHDGGKNTAPLVICSELHKSEESIVPRPEGKGHANGDVSLKVNSSLLPPKAPELKDIILSLPPDLGPALQELKAPSF
Host
Rabbit
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
ERMAP MaxPab rabbit polyclonal antibody. Western Blot analysis of ERMAP expression in HeLa.Western Blot (Transfected lysate)
Western Blot analysis of ERMAP expression in transfected 293T cell line (H00114625-T01) by ERMAP MaxPab polyclonal antibody.
Lane 1: ERMAP transfected lysate(52.60 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of ERMAP transfected lysate using anti-ERMAP MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with ERMAP purified MaxPab mouse polyclonal antibody (B01P) (H00114625-B01P). -
Gene Info — ERMAP
Entrez GeneID
114625GeneBank Accession#
NM_001017922.1Protein Accession#
NP_001017922.1Gene Name
ERMAP
Gene Alias
MGC118810, MGC118811, MGC118812, MGC118813, PRO2801, RD, SC
Gene Description
erythroblast membrane-associated protein (Scianna blood group)
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a cell surface transmembrane protein that may act as an erythroid cell receptor, possibly as a mediator of cell adhesion. Polymorphisms in this gene are responsible for the Scianna/Radin blood group system. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000008916|OTTHUMP00000008918|Radin blood group (Rd)|Scianna blood group (Sc)|erythroblast membrane-associated protein|erythroid membrane-associated protein
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com