Product Browser

Last updated: 2017/6/25

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ERMAP polyclonal antibody (A01)

  • Catalog # : H00114625-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant ERMAP.
  • Immunogen:
  • ERMAP (NP_001017922, 376 a.a. ~ 475 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • NKSHIFTFTHNFSGPLRPFFEPCLHDGGKNTAPLVICSELHKSEESIVPRPEGKGHANGDVSLKVNSSLLPPKAPELKDIILSLPPDLGPALQELKAPSF
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00114625-A01
    Western Blot detection against Immunogen (37.11 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • ERMAP
  • Gene Alias:
  • MGC118810,MGC118811,MGC118812,MGC118813,PRO2801,RD,SC
  • Gene Description:
  • erythroblast membrane-associated protein (Scianna blood group)
  • Gene Summary:
  • The protein encoded by this gene is a cell surface transmembrane protein that may act as an erythroid cell receptor, possibly as a mediator of cell adhesion. Polymorphisms in this gene are responsible for the Scianna/Radin blood group system. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000008916,OTTHUMP00000008918,Radin blood group (Rd),Scianna blood group (Sc),erythroblast membrane-associated protein,erythroid membrane-associated protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook