PALM2 monoclonal antibody (M09), clone 1A8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant PALM2.
Immunogen
PALM2 (NP_443749, 321 a.a. ~ 411 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
EDEEETKKVLGYDETIKAELVLIDEDDEKSLREKTVTDVSTIDGNAAELVSGRPVSDTTEPSSPEGKEESLATEPAPGTQKKKRCQCCVVM
Host
Mouse
Reactivity
Human, Rat
Interspecies Antigen Sequence
Mouse (91)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.75 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
PALM2 monoclonal antibody (M09), clone 1A8. Western Blot analysis of PALM2 expression in PC-12 ( Cat # L012V1 ).Western Blot (Cell lysate)
PALM2 monoclonal antibody (M09), clone 1A8 Western Blot analysis of PALM2 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Transfected lysate)
Western Blot analysis of PALM2 expression in transfected 293T cell line by PALM2 monoclonal antibody (M09), clone 1A8.
Lane 1: PALM2 transfected lysate(42.2 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PALM2 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — PALM2
-
Disease
-
Publication Reference
-
Prenylated PALM2 Promotes the Migration of Esophageal Squamous Cell Carcinoma Cells through Activating Ezrin.
Dan-Xia Deng, Cheng-Yu Li, Zhen-Yuan Zheng, Bing Wen, Lian-Di Liao, Xiao-Jun Zhang, En-Min Li, Li-Yan Xu.
Molecular & Cellular proteomics: MCP 2023 Jun; 100593:0.
Application:WB-Ti, Human, Human esophageal cancer, normal esophageal epithelial.
-
Prenylated PALM2 Promotes the Migration of Esophageal Squamous Cell Carcinoma Cells through Activating Ezrin.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com