DTX2 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
DTX2 MaxPab rabbit polyclonal antibody. Western Blot analysis of DTX2 expression in human stomach.
Western Blot (Tissue lysate)
DTX2 MaxPab rabbit polyclonal antibody. Western Blot analysis of DTX2 expression in mouse brain.
Western Blot (Transfected lysate)
Western Blot analysis of DTX2 expression in transfected 293T cell line (H00113878-T01) by DTX2 MaxPab polyclonal antibody.
Lane 1: DTX2 transfected lysate(67.20 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human DTX2 protein.
Immunogen
DTX2 (NP_065943.1, 1 a.a. ~ 622 a.a) full-length human protein.
Sequence
MAMAPSPSLVQVYTSPAAVAVWEWQDGLGTWHPYSATVCSFIEQQFVQQKGQRFGLGSLAHSIPLGQADPSLAPYIIDLPSWTQFRQDTGTMRAVRRHLFPQHSAPGRGVVWEWLSDDGSWTAYEASVCDYLEQQVARGNQLVDLAPLGYNYTVNYTTHTQTNKTSSFCRSVRRQAGPPYPVTTIIAPPGHTGVACSCHQCLSGSRTGPVSGRYRHSMTNLPAYPVPQHPPHRTASVFGTHQAFAPYNKPSLSGARSAPRLNTTNAWGAAPPSLGSQPLYRSSLSHLGPQHLPPGSSTSGAVSASLPSGPSSSPGSVPATVPMQMPKPSRVQQALAGMTSVLMSAIGLPVCLSRAPQPTSPPASRLASKSHGSVKRLRKMSVKGATPKPEPEPEQVIKNYTEELKVPPDEDCIICMEKLSAASGYSDVTDSKAIGSLAVGHLTKCSHAFHLLCLLAMYCNGNKDGSLQCPSCKTIYGEKTGTQPQGKMEVLRFQMSLPGHEDCGTILIVYSIPHGIQGPEHPNPGKPFTARGFPRQCYLPDNAQGRKVLELLKVAWKRRLIFTVGTSSTTGETDTVVWNEIHHKTEMDRNITGHGYPDPNYLQNVLAELAAQGVTEDCLEQQ
Host
Rabbit
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (84); Rat (85)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
DTX2 MaxPab rabbit polyclonal antibody. Western Blot analysis of DTX2 expression in human stomach.Western Blot (Tissue lysate)
DTX2 MaxPab rabbit polyclonal antibody. Western Blot analysis of DTX2 expression in mouse brain.Western Blot (Transfected lysate)
Western Blot analysis of DTX2 expression in transfected 293T cell line (H00113878-T01) by DTX2 MaxPab polyclonal antibody.
Lane 1: DTX2 transfected lysate(67.20 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — DTX2
Entrez GeneID
113878GeneBank Accession#
NM_020892.1Protein Accession#
NP_065943.1Gene Name
DTX2
Gene Alias
KIAA1528, MGC71098, RNF58
Gene Description
deltex homolog 2 (Drosophila)
Gene Ontology
HyperlinkOther Designations
OTTHUMP00000024490|deltex 2|ring finger protein 58|zinc ion binding protein
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com