Product Browser

Last updated: 2017/7/23

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MED8 (Human) Recombinant Protein (Q01)

  • Catalog # : H00112950-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human MED8 partial ORF ( NP_443109, 1 a.a. - 59 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MRQTEGRVPVFSHEVVPDHLRTKPDPEVEEQEKQLTTDAARIGADAAQKQIQSLNKMCS
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 32.23
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00112950-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • MED8
  • Gene Alias:
  • ARC32,MGC17544,MGC19641
  • Gene Description:
  • mediator complex subunit 8
  • Gene Summary:
  • This gene encodes a protein that is one of more than 20 subunits of the mediator complex, first identified in S. cerevisiae, that is required for activation of transcription. The product of this gene also interacts with elongins B and C, and CUL2 and RBX1, to reconstitute a ubiquitin ligase. Two alternative transcripts encoding different isoforms have been described. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000008573,OTTHUMP00000008581,activator-recruited cofactor 32 kDa component,mediator of RNA polymerase II transcription subunit MED8,mediator of RNA polymerase II transcription, subunit 8 homolog
  • RSS
  • YouTube
  • Linkedin
  • Facebook