MED8 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human MED8 partial ORF ( NP_443109, 1 a.a. - 59 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MRQTEGRVPVFSHEVVPDHLRTKPDPEVEEQEKQLTTDAARIGADAAQKQIQSLNKMCS
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
32.23
Interspecies Antigen Sequence
Mouse (96)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — MED8
Entrez GeneID
112950GeneBank Accession#
NM_052877Protein Accession#
NP_443109Gene Name
MED8
Gene Alias
ARC32, MGC17544, MGC19641
Gene Description
mediator complex subunit 8
Omim ID
607956Gene Ontology
HyperlinkGene Summary
This gene encodes a protein that is one of more than 20 subunits of the mediator complex, first identified in S. cerevisiae, that is required for activation of transcription. The product of this gene also interacts with elongins B and C, and CUL2 and RBX1, to reconstitute a ubiquitin ligase. Two alternative transcripts encoding different isoforms have been described. [provided by RefSeq
Other Designations
OTTHUMP00000008573|OTTHUMP00000008581|activator-recruited cofactor 32 kDa component|mediator of RNA polymerase II transcription subunit MED8|mediator of RNA polymerase II transcription, subunit 8 homolog
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com