Product Browser

Last updated: 2017/2/19
  • Related Product Showcase
  • By Application

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MED8 monoclonal antibody (M01), clone 1D3

  • Catalog # : H00112950-M01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant MED8.
  • Immunogen:
  • MED8 (NP_443109, 1 a.a. ~ 59 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • MRQTEGRVPVFSHEVVPDHLRTKPDPEVEEQEKQLTTDAARIGADAAQKQIQSLNKMCS
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00112950-M01
    Western Blot detection against Immunogen (32.23 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged MED8 is approximately 0.1ng/ml as a capture antibody.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • enlarge
  • ELISA
  • Gene Information
  • Gene Name:
  • MED8
  • Gene Alias:
  • ARC32,MGC17544,MGC19641
  • Gene Description:
  • mediator complex subunit 8
  • Gene Summary:
  • This gene encodes a protein that is one of more than 20 subunits of the mediator complex, first identified in S. cerevisiae, that is required for activation of transcription. The product of this gene also interacts with elongins B and C, and CUL2 and RBX1, to reconstitute a ubiquitin ligase. Two alternative transcripts encoding different isoforms have been described. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000008573,OTTHUMP00000008581,activator-recruited cofactor 32 kDa component,mediator of RNA polymerase II transcription subunit MED8,mediator of RNA polymerase II transcription, subunit 8 homolog
  • RSS
  • YouTube
  • Linkedin
  • Facebook