EPSTI1 monoclonal antibody (M02), clone 3G7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant EPSTI1.
Immunogen
EPSTI1 (NP_001002264, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MNTRNRVVNSGLGASPASRPTRDPQDPSGRQGELSPVEDQREGLEAAPKGPSRESVVHAGQRRTSAYTLIAPNINRRNEIQRIAEQELANLEKWKEQNRA
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (66); Rat (65)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged EPSTI1 is 0.1 ng/ml as a capture antibody.ELISA
-
Gene Info — EPSTI1
Entrez GeneID
94240GeneBank Accession#
NM_001002264Protein Accession#
NP_001002264Gene Name
EPSTI1
Gene Alias
BRESI1, MGC29634
Gene Description
epithelial stromal interaction 1 (breast)
Omim ID
607441Gene Ontology
HyperlinkOther Designations
OTTHUMP00000018331|epithelial stromal interaction 1
-
Interactome
-
Publication Reference
-
Cigarette smoke modulates expression of human rhinovirus-induced airway epithelial host defense genes.
Proud D, Hudy MH, Wiehler S, Zaheer RS, Amin MA, Pelikan JB, Tacon CE, Tonsaker TO, Walker BL, Kooi C, Traves SL, Leigh R.
PLoS One 2012 Jul; 7(7):e40762.
Application:WB-Ce, Human, Epithelial cell cultures from normal human lungs.
-
Epithelial-Stromal Interaction 1 (EPSTI1) Substitutes for Peritumoral Fibroblasts in the Tumor Microenvironment.
de Neergaard M, Kim J, Villadsen R, Fridriksdottir AJ, Rank F, Timmermans-Wielenga V, Langerod A, Borresen-Dale AL, Petersen OW, Ronnov-Jessen L.
The American Journal of Pathology 2010 Mar; 176(3):1227.
Application:WB-Ce, WB-Tr, Human, MDA-MB-231 cells.
-
Cigarette smoke modulates expression of human rhinovirus-induced airway epithelial host defense genes.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com