EPSTI1 monoclonal antibody (M01), clone 2A8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
EPSTI1 monoclonal antibody (M01), clone 2A8 Western Blot analysis of EPSTI1 expression in A-431( Cat # L015V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of EPSTI1 expression in transfected 293T cell line by EPSTI1 monoclonal antibody (M01), clone 2A8.
Lane 1: EPSTI1 transfected lysate(36.793 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to EPSTI1 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged EPSTI1 is approximately 0.03ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant EPSTI1.
Immunogen
EPSTI1 (NP_001002264, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MNTRNRVVNSGLGASPASRPTRDPQDPSGRQGELSPVEDQREGLEAAPKGPSRESVVHAGQRRTSAYTLIAPNINRRNEIQRIAEQELANLEKWKEQNRA
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (66); Rat (65)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
EPSTI1 monoclonal antibody (M01), clone 2A8 Western Blot analysis of EPSTI1 expression in A-431( Cat # L015V1 ).Western Blot (Transfected lysate)
Western Blot analysis of EPSTI1 expression in transfected 293T cell line by EPSTI1 monoclonal antibody (M01), clone 2A8.
Lane 1: EPSTI1 transfected lysate(36.793 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to EPSTI1 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged EPSTI1 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — EPSTI1
Entrez GeneID
94240GeneBank Accession#
NM_001002264Protein Accession#
NP_001002264Gene Name
EPSTI1
Gene Alias
BRESI1, MGC29634
Gene Description
epithelial stromal interaction 1 (breast)
Omim ID
607441Gene Ontology
HyperlinkOther Designations
OTTHUMP00000018331|epithelial stromal interaction 1
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com