FOXP2 monoclonal antibody (M02), clone 1F8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged FOXP2 is 0.3 ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to FOXP2 on HeLa cell . [antibody concentration 5 ug/ml]
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant FOXP2.
Immunogen
FOXP2 (NP_055306, 616 a.a. ~ 715 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
LAESSLPLLSNPGLINNASSGLLQAVHEDLNGSLDHIDSNGNSSPGCSPQPHIHSIHVKEEPVIAEDEDCPMSLVTTANHSPELEDDREIEEEPLSEDLE
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Rat (61)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged FOXP2 is 0.3 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to FOXP2 on HeLa cell . [antibody concentration 5 ug/ml] -
Gene Info — FOXP2
Entrez GeneID
93986GeneBank Accession#
NM_014491Protein Accession#
NP_055306Gene Name
FOXP2
Gene Alias
CAGH44, DKFZp686H1726, SPCH1, TNRC10
Gene Description
forkhead box P2
Gene Ontology
HyperlinkGene Summary
This gene encodes an evolutionarily conserved transcription factor expressed in fetal and adult brain. This transcription factor is a member of the forkhead/winged-helix (FOX) family of transcription factors, and contains a FOX DNA-binding domain and a large polyglutamine tract. Members of the FOX family of transcription factors are regulators of embryogenesis. The product of this gene is thought to be required for proper development of speech and language regions of the brain during embryogenesis. Although a point mutation in this gene has been associated with the KE pedigree segregating developmental verbal dyspraxia, no association between mutations in this gene and another speech disorder, autism, has been found. Multiple alternative transcripts encoding different isoforms have been identified. [provided by RefSeq
Other Designations
CAG repeat protein 44|OTTHUMP00000067772|forkhead/winged-helix transcription factor|speech and language disorder 1|trinucleotide repeat containing 10
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com