CAPZA3 monoclonal antibody (M01A), clone 4D6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
CAPZA3 monoclonal antibody (M01A), clone 4D6. Western Blot analysis of CAPZA3 expression in PC-12 ( Cat # L012V1 ).
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CAPZA3.
Immunogen
CAPZA3 (NP_201585, 200 a.a. ~ 299 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
NLHIEISKDLKESLEIVNQAQLALSFARLVEEQENKFQAAVLEELQELSNEALRKILRRDLPVTRTLIDWHRILSDLNLVMYPKLGYVIYSRSVLCNWII
Host
Mouse
Reactivity
Human, Rat
Interspecies Antigen Sequence
Mouse (90); Rat (89)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In ascites fluid
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
CAPZA3 monoclonal antibody (M01A), clone 4D6. Western Blot analysis of CAPZA3 expression in PC-12 ( Cat # L012V1 ).ELISA
-
Gene Info — CAPZA3
Entrez GeneID
93661GeneBank Accession#
NM_033328Protein Accession#
NP_201585Gene Name
CAPZA3
Gene Alias
CAPPA3, Gsg3
Gene Description
capping protein (actin filament) muscle Z-line, alpha 3
Omim ID
608722Gene Ontology
HyperlinkGene Summary
This gene encodes an actin capping protein, one of the F-actin capping protein alpha subunit family. The encoded protein is predominantly localized to the neck region of ejaculated sperm, other immunohistochemical signals were found in the tail and postacrosomal regions. The encoded protein may also form heterodimers of alpha and beta subunits. This protein may be important in determining sperm architecture and male fertility. [provided by RefSeq
Other Designations
CapZ alpha-3|F-actin capping protein alpha-3 subunit|capping protein alpha 3
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com