Product Browser

Last updated: 2017/7/16
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CAPZA3 polyclonal antibody (A01)

  • Catalog # : H00093661-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant CAPZA3.
  • Immunogen:
  • CAPZA3 (NP_201585, 200 a.a. ~ 299 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • NLHIEISKDLKESLEIVNQAQLALSFARLVEEQENKFQAAVLEELQELSNEALRKILRRDLPVTRTLIDWHRILSDLNLVMYPKLGYVIYSRSVLCNWII
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00093661-A01
    Western Blot detection against Immunogen (37.11 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • CAPZA3
  • Gene Alias:
  • CAPPA3,Gsg3
  • Gene Description:
  • capping protein (actin filament) muscle Z-line, alpha 3
  • Gene Summary:
  • This gene encodes an actin capping protein, one of the F-actin capping protein alpha subunit family. The encoded protein is predominantly localized to the neck region of ejaculated sperm, other immunohistochemical signals were found in the tail and postacrosomal regions. The encoded protein may also form heterodimers of alpha and beta subunits. This protein may be important in determining sperm architecture and male fertility. [provided by RefSeq
  • Other Designations:
  • CapZ alpha-3,F-actin capping protein alpha-3 subunit,capping protein alpha 3
  • RSS
  • YouTube
  • Linkedin
  • Facebook