CGB5 monoclonal antibody (M02), clone 2E7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of CGB5 expression in transfected 293T cell line by CGB5 monoclonal antibody (M02), clone 2E7.
Lane 1: CGB5 transfected lysate (Predicted MW: 17.7 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CGB5 is 0.03 ng/ml as a capture antibody.
Western Blot detection against Immunogen (43.89 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant CGB5.
Immunogen
CGB5 (AAH06290, 1 a.a. ~ 165 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MEMFQGLLLLLLLSMGGTWASKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQ
Host
Mouse
Reactivity
Human
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (43.89 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of CGB5 expression in transfected 293T cell line by CGB5 monoclonal antibody (M02), clone 2E7.
Lane 1: CGB5 transfected lysate (Predicted MW: 17.7 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CGB5 is 0.03 ng/ml as a capture antibody.ELISA
-
Gene Info — CGB5
Entrez GeneID
93659GeneBank Accession#
BC006290Protein Accession#
AAH06290Gene Name
CGB5
Gene Alias
HCG, MGC119822
Gene Description
chorionic gonadotropin, beta polypeptide 5
Omim ID
608825Gene Ontology
HyperlinkGene Summary
This gene is a member of the glycoprotein hormone beta chain family and encodes the beta 5 subunit of chorionic gonadotropin (CG). Glycoprotein hormones are heterodimers consisting of a common alpha subunit and an unique beta subunit which confers biological specificity. CG is produced by the trophoblastic cells of the placenta and stimulates the ovaries to synthesize the steroids that are essential for the maintenance of pregnancy. The beta subunit of CG is encoded by 6 genes which are arranged in tandem and inverted pairs on chromosome 19q13.3 and contiguous with the luteinizing hormone beta subunit gene. [provided by RefSeq
Other Designations
chorionic gonadotropin beta 5 subunit
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com