Product Browser

Last updated: 2017/12/17
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

IGSF8 polyclonal antibody (A01)

  • Catalog # : H00093185-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant IGSF8.
  • Immunogen:
  • IGSF8 (AAH04108, 220 a.a. ~ 322 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • PAGAPGPGRLVAQLDTEGVGSLGPGYEGRHIAMEKVASRTYRLRLEAARPGDAGTYRCLAKAYVRGSGTRLREAASARSRPLPVHVREEGVVLEAVAWLAGGT
  • Host:
  • Mouse
  • Reactivity:
  • Human, Mouse
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00093185-A01
    Western Blot detection against Immunogen (37.44 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • IGSF8 polyclonal antibody (A01). Western Blot analysis of IGSF8 expression in Raw 264.7.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • IGSF8
  • Gene Alias:
  • CD316,CD81P3,EWI2,PGRL
  • Gene Description:
  • immunoglobulin superfamily, member 8
  • Other Designations:
  • CD81 partner 3,OTTHUMP00000025751,OTTHUMP00000025753
  • RSS
  • YouTube
  • Linkedin
  • Facebook