PIGM (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human PIGM partial ORF ( NP_660150, 35 a.a. - 96 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
YGVFQDRTLHVRYTDIDYQVFTDAARFVTEGRSPYLRATYRYTPLLGWLLTPNIYLSELFGK
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
32.56
Interspecies Antigen Sequence
Mouse (94); Rat (94)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — PIGM
Entrez GeneID
93183GeneBank Accession#
NM_145167Protein Accession#
NP_660150Gene Name
PIGM
Gene Alias
GPI-MT-I, MGC29896
Gene Description
phosphatidylinositol glycan anchor biosynthesis, class M
Gene Ontology
HyperlinkGene Summary
This gene encodes a transmembrane protein that is located in the endoplasmic reticulum and is involved in GPI-anchor biosynthesis. The glycosylphosphatidylinositol (GPI)-anchor is a glycolipid which contains three mannose molecules in its core backbone. The GPI-anchor is found on many blood cells and serves to anchor proteins to the cell surface. This gene encodes a mannosyltransferase, GPI-MT-I, that transfers the first mannose to GPI on the lumenal side of the endoplasmic reticulum. [provided by RefSeq
Other Designations
OTTHUMP00000025755|PIG-M mannosyltransferase|phosphatidylinositol glycan, class M
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com