Product Browser

Last updated: 2016/12/11

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MARS2 monoclonal antibody (M03), clone 7C3

  • Catalog # : H00092935-M03
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant MARS2.
  • Immunogen:
  • MARS2 (NP_612404, 1 a.a. ~ 106 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • MLRTSVLRLLGRTGASRLSLLEDFGPRYYSSGSLSAGDDACDVRAYFTTPIFYVNAAPHIGHLYSALLADALCRHRRLRGPSTAATRFSTGTDEHGLKIQQAAATA
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00092935-M03
    Western Blot detection against Immunogen (37.4 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • MARS2 monoclonal antibody (M03), clone 7C3. Western Blot analysis of MARS2 expression in MCF-7.
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of MARS2 expression in transfected 293T cell line by MARS2 monoclonal antibody (M03), clone 7C3.

    Lane 1: MARS2 transfected lysate (Predicted MW: 66.6 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged MARS2 is 0.1 ng/ml as a capture antibody.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • enlarge
  • ELISA
  • Gene Information
  • Gene Name:
  • MARS2
  • Gene Alias:
  • MetRS,mtMetRS
  • Gene Description:
  • methionyl-tRNA synthetase 2, mitochondrial
  • Other Designations:
  • methionine tRNA ligase 2, mitochondrial,methionine-tRNA ligase,methionine-tRNA synthetase 2,methionine-tRNA synthetase 2 (mitochondrial),methionine-tRNA synthetase 2, mitochondrial,mitochondrial methionyl-tRNA synthetase
  • RSS
  • YouTube
  • Linkedin
  • Facebook