Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Pathway

  • By Application

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MOBKL1A monoclonal antibody (M07), clone 2F8

  • Catalog # : H00092597-M07
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant MOBKL1A.
  • Immunogen:
  • MOBKL1A (NP_775739.1, 120 a.a. ~ 216 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • TWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDPVIQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKLTSKDR
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG1 Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • ELISA
  • Gene Information
  • Gene Name:
  • MOBKL1A
  • Gene Alias:
  • MATS2,MGC33910,MOB4A,Mob1B
  • Gene Description:
  • MOB1, Mps One Binder kinase activator-like 1A (yeast)
  • Gene Summary:
  • The protein encoded by this gene is similar to the yeast Mob1 protein. Yeast Mob1 binds Mps1p, a protein kinase essential for spindle pole body duplication and mitotic checkpoint regulation. [provided by RefSeq
  • Other Designations:
  • MOB1, Mps One Binder kinase activator-like 1A
  • RSS
  • YouTube
  • Linkedin
  • Facebook