LYK5 monoclonal antibody (M02), clone 4E4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
LYK5 monoclonal antibody (M02), clone 4E4. Western Blot analysis of LYK5 expression in Hela S3 NE ( Cat # L013V3 ).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to STRADA on formalin-fixed paraffin-embedded human uterine cervix. [antibody concentration 6 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged STRADA is 0.03 ng/ml as a capture antibody.
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between STK11 and STRADA. HeLa cells were stained with anti-STK11 rabbit purified polyclonal 1:1200 and anti-STRADA mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
Western Blot detection against Immunogen (36.3 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant LYK5.
Immunogen
LYK5 (NP_699166.2, 251 a.a. ~ 346 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
LLEKLNGTVPCLLDTSTIPAEELTMSPSRSVANSGLSDSLTTSTPRPSNGDSPSHPYHRTFSPHFHHFVEQCLQRNPDARYPCWPGPGLRESRGCS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (89)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.3 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
LYK5 monoclonal antibody (M02), clone 4E4. Western Blot analysis of LYK5 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to STRADA on formalin-fixed paraffin-embedded human uterine cervix. [antibody concentration 6 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged STRADA is 0.03 ng/ml as a capture antibody.ELISA
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between STK11 and STRADA. HeLa cells were stained with anti-STK11 rabbit purified polyclonal 1:1200 and anti-STRADA mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). -
Gene Info — STRADA
Entrez GeneID
92335GeneBank Accession#
NM_153335Protein Accession#
NP_699166.2Gene Name
STRADA
Gene Alias
FLJ90524, LYK5, NY-BR-96, PMSE, STRAD, Stlk
Gene Description
STE20-related kinase adaptor alpha
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene contains a STE20-like kinase domain, but lacks several residues that are critical for catalytic activity, so it is termed a 'pseudokinase'. The protein forms a heterotrimeric complex with serine/threonine kinase 11 (STK11, also known as LKB1) and the scaffolding protein calcium binding protein 39 (CAB39, also known as MO25). The protein activates STK11 leading to the phosphorylation of both proteins and excluding STK11 from the nucleus. The protein is necessary for STK11-induced G1 cell cycle arrest. A mutation in this gene has been shown to result in polyhydramnios, megalencephaly, and symptomatic epilepsy (PMSE) syndrome. Multiple transcript variants encoding different isoforms have been found for this gene. Additional transcript variants have been described but their full-length nature is not known. [provided by RefSeq
Other Designations
STE20-like pseudokinase|STE20-related adaptor protein|protein kinase LYK5
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com