Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PCDH21 polyclonal antibody (A01)

  • Catalog # : H00092211-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant PCDH21.
  • Immunogen:
  • PCDH21 (NP_149091, 113 a.a. ~ 211 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • GLNLVAEKVVILVTDANDEAPRFIQEPYVALVPEDIPAGSIIFKVHAVDRDTGSGGSVTYFLQNLHSPFAVDRHSGVLRLQAGATLDYERSRTHYITVV
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00092211-A01
    Western Blot detection against Immunogen (37 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • PCDH21
  • Gene Alias:
  • DKFZp434A132,KIAA1775,PRCAD
  • Gene Description:
  • protocadherin 21
  • Gene Summary:
  • This gene is a member of the cadherin superfamily of calcium-dependent cell-cell adhesion molecules. The encoded protein has a signal peptide, six cadherin repeat domains and a unique cytoplasmic region. This non-classical cadherin appears to be exclusively expressed in the mitral and tufted cells in the main and accessory olfactory bulbs of the brain, suggesting a possible role in the formation and maintenance of neuronal networks. [provided by RefSeq
  • Other Designations:
  • MT-protocadherin,OTTHUMP00000019993
  • RSS
  • YouTube
  • Linkedin
  • Facebook