GGTLA4 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human GGTLA4 full-length ORF ( NP_563577.1, 1 a.a. - 225 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MTSEFFSAQLRAQISDDTTHPISYYKPEFYMPDDGGTAHLSVVAEDGSAVSATSTINLYFGSKVRSPVSGILLNNEMDDFSSTSITNEFGVPPSPANFIQPGKQPLSSMCPTIMVGQDGQVRMVVGAAGGTQITMATALAIIYNLWFGYDVKWAVEEPRLHNQLLPNVTTVERNIDQEVTAALETRHHHTQITSTFIAVVQAIVRMAGGWAAASDSRKGGEPAGY
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
50.7
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — GGTLC1
Entrez GeneID
92086GeneBank Accession#
NM_080920.2Protein Accession#
NP_563577.1Gene Name
GGTLC1
Gene Alias
GGTL6, GGTLA3, GGTLA4, MGC50550, dJ831C21.1, dJ831C21.2
Gene Description
gamma-glutamyltransferase light chain 1
Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the gamma-glutamyl transpeptidase (GGT) family, which are important in the metabolism of glutathione. The most ubiquitously expressed human GGT gene, GGT1, encodes a single transmembrane polypeptide that is post-translationally processed to form a heavy and a light chain. In contrast, the product of this gene only contains homology to the light chain region, and lacks a transmembrane domain. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq
Other Designations
OTTHUMP00000030453|OTTHUMP00000030455|OTTHUMP00000030458|gamma-glutamyl transpeptidase|gamma-glutamyltransferase-like activity 3|gamma-glutamyltransferase-like activity 4|gamma-glutamyltransferase-like protein 6|gamma-glutamyltranspeptidase-like
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com