GGTLA4 MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of GGTLC1 expression in transfected 293T cell line (H00092086-T01) by GGTLC1 MaxPab polyclonal antibody.
Lane 1: GGTLA4 transfected lysate(24.75 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human GGTLA4 protein.
Immunogen
GGTLA4 (NP_563577, 1 a.a. ~ 225 a.a) full-length human protein.
Sequence
MTSEFFSAQLRAQISDDTTHPISYYKPEFYMPDDGGTAHLSVVAEDGSAVSATSTINLYFGSKVRSPVSGILLNNEMDDFSSTSITNEFGVPPSPANFIQPGKQPLSSMCPTIMVGQDGQVRMVVGAAGGTQITMATALAIIYNLWFGYDVKWAVEEPRLHNQLLPNVTTVERNIDQEVTAALETRHHHTQITSTFIAVVQAIVRMAGGWAAASDSRKGGEPAGY
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of GGTLC1 expression in transfected 293T cell line (H00092086-T01) by GGTLC1 MaxPab polyclonal antibody.
Lane 1: GGTLA4 transfected lysate(24.75 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — GGTLC1
Entrez GeneID
92086GeneBank Accession#
NM_080920Protein Accession#
NP_563577Gene Name
GGTLC1
Gene Alias
GGTL6, GGTLA3, GGTLA4, MGC50550, dJ831C21.1, dJ831C21.2
Gene Description
gamma-glutamyltransferase light chain 1
Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the gamma-glutamyl transpeptidase (GGT) family, which are important in the metabolism of glutathione. The most ubiquitously expressed human GGT gene, GGT1, encodes a single transmembrane polypeptide that is post-translationally processed to form a heavy and a light chain. In contrast, the product of this gene only contains homology to the light chain region, and lacks a transmembrane domain. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq
Other Designations
OTTHUMP00000030453|OTTHUMP00000030455|OTTHUMP00000030458|gamma-glutamyl transpeptidase|gamma-glutamyltransferase-like activity 3|gamma-glutamyltransferase-like activity 4|gamma-glutamyltransferase-like protein 6|gamma-glutamyltranspeptidase-like
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com