Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

GGTLA4 MaxPab mouse polyclonal antibody (B01)MaxPab

  • Catalog # : H00092086-B01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human GGTLA4 protein.
  • Immunogen:
  • GGTLA4 (NP_563577, 1 a.a. ~ 225 a.a) full-length human protein.
  • Sequence:
  • MTSEFFSAQLRAQISDDTTHPISYYKPEFYMPDDGGTAHLSVVAEDGSAVSATSTINLYFGSKVRSPVSGILLNNEMDDFSSTSITNEFGVPPSPANFIQPGKQPLSSMCPTIMVGQDGQVRMVVGAAGGTQITMATALAIIYNLWFGYDVKWAVEEPRLHNQLLPNVTTVERNIDQEVTAALETRHHHTQITSTFIAVVQAIVRMAGGWAAASDSRKGGEPAGY
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of GGTLC1 expression in transfected 293T cell line (H00092086-T01) by GGTLC1 MaxPab polyclonal antibody.

    Lane 1: GGTLA4 transfected lysate(24.75 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • GGTLC1
  • Gene Alias:
  • GGTL6,GGTLA3,GGTLA4,MGC50550,dJ831C21.1,dJ831C21.2
  • Gene Description:
  • gamma-glutamyltransferase light chain 1
  • Gene Summary:
  • This gene encodes a member of the gamma-glutamyl transpeptidase (GGT) family, which are important in the metabolism of glutathione. The most ubiquitously expressed human GGT gene, GGT1, encodes a single transmembrane polypeptide that is post-translationally processed to form a heavy and a light chain. In contrast, the product of this gene only contains homology to the light chain region, and lacks a transmembrane domain. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000030453,OTTHUMP00000030455,OTTHUMP00000030458,gamma-glutamyl transpeptidase,gamma-glutamyltransferase-like activity 3,gamma-glutamyltransferase-like activity 4,gamma-glutamyltransferase-like protein 6,gamma-glutamyltranspeptidase-like
  • RSS
  • YouTube
  • Linkedin
  • Facebook