Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NDUFAF2 purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00091942-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human NDUFAF2 protein.
  • Immunogen:
  • NDUFAF2 (ADZ16005.1, 1 a.a. ~ 169 a.a) full-length human protein.
  • Sequence:
  • MGWSQDLFRALWRSLSREVKEHVGTDQFGNKYYYIPQYKNWRGQTIREKRIVEAANKKEVDYEAGDIPTEWEAWIRRTRKTPPTMEEILKNEKHREEIKIKSQDFYEKEKLLSKETSEELLPPPVQTQIKGHASAPYFGKEEPSVAPSSTGKTFQPGSWMPRDGKSHNQ
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Application Image
  • Western Blot (Transfected lysate)
  • Gene Information
  • Gene Name:
  • NDUFAF2
  • Gene Alias:
  • B17.2L,FLJ22398,MMTN,NDUFA12L,mimitin
  • Gene Description:
  • NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, assembly factor 2
  • Gene Summary:
  • NADH:ubiquinone oxidoreductase (complex I) catalyzes the transfer of electrons from NADH to ubiquinone (coenzyme Q) in the first step of the mitochondrial respiratory chain, resulting in the translocation of protons across the inner mitochondrial membrane. This gene encodes a complex I assembly factor. Mutations in this gene cause progressive encephalopathy resulting from mitochondrial complex I deficiency. [provided by RefSeq
  • Other Designations:
  • Myc-induced mitochondrial protein,NDUFA12-like
  • RSS
  • YouTube
  • Linkedin
  • Facebook