NEK9 monoclonal antibody (M01), clone 1F6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
NEK9 monoclonal antibody (M01), clone 1F6. Western Blot analysis of NEK9 expression in NIH/3T3(Cat # L018V1 ).
Western Blot (Cell lysate)
NEK9 monoclonal antibody (M01), clone 1F6. Western Blot analysis of NEK9 expression in Raw 264.7(Cat # L024V1 ).
Western Blot (Cell lysate)
NEK9 monoclonal antibody (M01), clone 1F6 Western Blot analysis of NEK9 expression in HeLa ( Cat # L013V1 ).
Western Blot (Cell lysate)
NEK9 monoclonal antibody (M01), clone 1F6. Western Blot analysis of NEK9 expression in PC-12(Cat # L012V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of NEK9 expression in transfected 293T cell line by NEK9 monoclonal antibody (M01), clone 1F6.
Lane 1: NEK9 transfected lysate(107.2 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NEK9 is approximately 0.03ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to NEK9 on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant NEK9.
Immunogen
NEK9 (AAH09336, 226 a.a. ~ 326 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
AGKGTPLTPPACACSSLQVEVERLQGLVLKCLAEQQKLQQENLQIFTQLQKLNKKLEGGQQVGMHSKGTQTAKEEMEMDPKPDLDSDSWCLLGTDSCRPSL
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (89)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
NEK9 monoclonal antibody (M01), clone 1F6. Western Blot analysis of NEK9 expression in NIH/3T3(Cat # L018V1 ).Western Blot (Cell lysate)
NEK9 monoclonal antibody (M01), clone 1F6. Western Blot analysis of NEK9 expression in Raw 264.7(Cat # L024V1 ).Western Blot (Cell lysate)
NEK9 monoclonal antibody (M01), clone 1F6 Western Blot analysis of NEK9 expression in HeLa ( Cat # L013V1 ).Western Blot (Cell lysate)
NEK9 monoclonal antibody (M01), clone 1F6. Western Blot analysis of NEK9 expression in PC-12(Cat # L012V1 ).Western Blot (Transfected lysate)
Western Blot analysis of NEK9 expression in transfected 293T cell line by NEK9 monoclonal antibody (M01), clone 1F6.
Lane 1: NEK9 transfected lysate(107.2 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NEK9 is approximately 0.03ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to NEK9 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — NEK9
Entrez GeneID
91754GeneBank Accession#
BC009336Protein Accession#
AAH09336Gene Name
NEK9
Gene Alias
DKFZp434D0935, MGC138306, MGC16714, NERCC, NERCC1, Nek8
Gene Description
NIMA (never in mitosis gene a)- related kinase 9
Omim ID
609798Gene Ontology
HyperlinkOther Designations
NIMA related kinase 9|NIMA-related kinase Nek8
-
Interactome
-
Disease
-
Publication Reference
-
First insight into the kinome of human regulatory T cells.
König S, Probst-Kepper M, Reinl T, Jeron A, Huehn J, Schraven B, Jänsch L.
PLoS One 2012 Jul; 7(7):e40896.
Application：WB-Ce, Human, Human regulatory T cells (Tregs).
-
First insight into the kinome of human regulatory T cells.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com