Product Browser

Last updated: 2017/1/15

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

BTF3L4 monoclonal antibody (M05), clone 2G10

  • Catalog # : H00091408-M05
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a full-length recombinant BTF3L4.
  • Immunogen:
  • BTF3L4 (NP_689478.1, 1 a.a. ~ 158 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • MNQEKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQSSLKKLAVNNIAGIEEVNMIKDDGTVIHFNNPKVQASLSANTFAITGHAEAKPITEMLPGILSQLGADSLTSLRKLAEQFPRQVLDSKAPKPEDIDEEDDDVPDLVENFDEASKNEAN
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00091408-M05
    Western Blot detection against Immunogen (43.7 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • BTF3L4 monoclonal antibody (M05), clone 2G10. Western Blot analysis of BTF3L4 expression in HeLa.
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of BTF3L4 expression in transfected 293T cell line by BTF3L4 monoclonal antibody (M05), clone 2G10.

    Lane 1: BTF3L4 transfected lysate (Predicted MW: 17.3 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged BTF3L4 is 0.03 ng/ml as a capture antibody.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • enlarge
  • ELISA
  • Gene Information
  • Gene Name:
  • BTF3L4
  • Gene Alias:
  • MGC23908,MGC88389,RP4-800M22.5
  • Gene Description:
  • basic transcription factor 3-like 4
  • Other Designations:
  • OTTHUMP00000010514,OTTHUMP00000010515,transcription factor BTF3-like
  • RSS
  • YouTube
  • Linkedin
  • Facebook