Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NIP purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00090527-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human NIP protein.
  • Immunogen:
  • NIP (AAH20841, 1 a.a. ~ 298 a.a) full-length human protein.
  • Sequence:
  • MATLGHTFPFYAGPKPTFPMDTTLASIIMIFLTALATFIVILPGIRGKTRLFWLLRVVTSLFIGAAILGTPVQQLNETINYNEEFTWRLGENYAEEYAKALEKGLPDPVLYLAEKFTPRSPCGLYRQYRLAGHYTSAMLWVAFLCWLLANVMLSMPVLVYGGYMLLATGIFQLLALLFFSMATSLTSPCPLHLGASVLHTHHGPAFWITLTTGLLCVLLGLAMAVAHRMQPHRLKAFFNQSVDEDPMLEWSPEEGGLLSPRYRSMADSPKSQDIPLSEASSTKAYCKEAHPKDPDCAL
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of DUOXA1 expression in transfected 293T cell line (H00090527-T01) by DUOXA1 MaxPab polyclonal antibody.

    Lane 1: NIP transfected lysate(32.89 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • DUOXA1
  • Gene Alias:
  • FLJ32334,NIP,NUMBIP,mol
  • Gene Description:
  • dual oxidase maturation factor 1
  • Other Designations:
  • Numb-interacting protein,dual oxidase activator 1,dual oxidase maturation factor 1 alpha,dual oxidase maturation factor 1 beta,dual oxidase maturation factor 1 delta,dual oxidase maturation factor 1 gamma,homolog of Drosophila Numb-interacting protein
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook