Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

GADD45GIP1 purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00090480-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human GADD45GIP1 protein.
  • Immunogen:
  • GADD45GIP1 (NP_443082, 1 a.a. ~ 222 a.a) full-length human protein.
  • Sequence:
  • MAASVRQARSLLGVAATLAPGSRGYRARPPPRRRPGPRWPDPEDLLTPRWQLGPRYAAKQFARYGAASGVVPGSLWPSPEQLRELEAEEREWYPSLATMQESLRVKQLAEEQKRREREQHIAECMAKMPQMIVNWQQQQRENWEKAQADKERRARLQAEAQELLGYQVDPRSARFQELLQDLEKKERKRLKEEKQKRKKEARAAALAAAVAQDPAASGAPSS
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • GADD45GIP1 MaxPab polyclonal antibody. Western Blot analysis of GADD45GIP1 expression in A-431.
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of GADD45GIP1 expression in transfected 293T cell line (H00090480-T02) by GADD45GIP1 MaxPab polyclonal antibody.

    Lane 1: GADD45GIP1 transfected lysate(24.42 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • GADD45GIP1
  • Gene Alias:
  • CKBBP2,CRIF1,MGC4667,MGC4758,PLINP-1,PRG6,Plinp1
  • Gene Description:
  • growth arrest and DNA-damage-inducible, gamma interacting protein 1
  • Other Designations:
  • CKII beta binding protein 2,CR6 interacting factor 1,p53-responsive gene 6,papillomavirus L2 interacting nuclear protein 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook