ZNF622 monoclonal antibody (M01), clone 4G6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
ZNF622 monoclonal antibody (M01), clone 4G6. Western Blot analysis of ZNF622 expression in Hela S3 NE(Cat # L013V3 ).
Western Blot (Cell lysate)
ZNF622 monoclonal antibody (M01), clone 4G6. Western Blot analysis of ZNF622 expression in PC-12(Cat # L012V1 ).
Western Blot (Cell lysate)
ZNF622 monoclonal antibody (M01), clone 4G6. Western Blot analysis of ZNF622 expression in NIH/3T3(Cat # L018V1 ).
Western Blot (Cell lysate)
ZNF622 monoclonal antibody (M01), clone 4G6. Western Blot analysis of ZNF622 expression in Raw 264.7(Cat # L024V1 ).
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ZNF622.
Immunogen
ZNF622 (NP_219482, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MATYTCITCRVAFRDADMQRAHYKTDWHRYNLRRKVASMAPVTAEGFQERVRAQRAVAEEESKGSATYCTVCSKKFASFNAYENHLKSRRHVELEKKAVQ
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (85); Rat (96)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
ZNF622 monoclonal antibody (M01), clone 4G6. Western Blot analysis of ZNF622 expression in Hela S3 NE(Cat # L013V3 ).Western Blot (Cell lysate)
ZNF622 monoclonal antibody (M01), clone 4G6. Western Blot analysis of ZNF622 expression in PC-12(Cat # L012V1 ).Western Blot (Cell lysate)
ZNF622 monoclonal antibody (M01), clone 4G6. Western Blot analysis of ZNF622 expression in NIH/3T3(Cat # L018V1 ).Western Blot (Cell lysate)
ZNF622 monoclonal antibody (M01), clone 4G6. Western Blot analysis of ZNF622 expression in Raw 264.7(Cat # L024V1 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — ZNF622
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com