Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ZNF622 MaxPab rabbit polyclonal antibody (D01)MaxPab

  • Catalog # : H00090441-D01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human ZNF622 protein.
  • Immunogen:
  • ZNF622 (NP_219482.1, 1 a.a. ~ 477 a.a) full-length human protein.
  • Sequence:
  • MATYTCITCRVAFRDADMQRAHYKTDWHRYNLRRKVASMAPVTAEGFQERVRAQRAVAEEESKGSATYCTVCSKKFASFNAYENHLKSRRHVELEKKAVQAVNRKVEMMNEKNLEKGLGVDSVDKDAMNAAIQQAIKAQPSMSPKKAPPAPAKEARNVVAVGTGGRGTHDRDPSEKPPRLQWFEQQAKKLAKQQEEDSEEEEEDLDGDDWEDIDSDEELECEDTEAMDDVVEQDAEEEEAEEGPPLGAIPITDCLFCSHHSSSLMKNVAHMTKDHSFFIPDIEYLSDIKGLIKYLGEKVGVGKICLWCNEKGKSFYSTEAVQAHMNDKSHCKLFTDGDAALEFADFYDFRSSYPDHKEGEDPNKAEELPSEKNLEYDDETMELILPSGARVGHRSLMRYYKQRFGLSRAVAVAKNRKAVGRVLQQYRALGWTGSTGAALMRERDMQYVQRMKSKWMLKTGMKNNATKQMHFRVQVRF
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Immunoprecipitation
  • Immunoprecipitation
  • Immunoprecipitation of ZNF622 transfected lysate using anti-ZNF622 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with ZNF622 MaxPab mouse polyclonal antibody (B01) (H00090441-B01).
  • PDF DownloadProtocol Download
  • Application Image
  • Gene Information
  • Gene Name:
  • ZNF622
  • Gene Alias:
  • MGC17552,MGC2485,ZPR9
  • Gene Description:
  • zinc finger protein 622
  • Other Designations:
  • zinc finger-like protein 9
  • RSS
  • YouTube
  • Linkedin
  • Facebook