Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ZNF160 (Human) Recombinant Protein (P01)

  • Catalog # : H00090338-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human ZNF160 full-length ORF ( ENSP00000347273, 1 a.a. - 147 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MALTQVRLTFRDVAIEFSQEEWKCLDPAQRILYRDVMLENYWNLVSLGLCHFDMNIISMLEEGKEPWTVKSCVKIARKPRTPECVKGVVTDLLRRWKHWLLLLGICCPKPHGRVSSRLRLSRSLGHFFHSAFATFMGVCDKRVGSIF
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 43.5
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00090338-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • ZNF160
  • Gene Alias:
  • DKFZp686B16128,F11,FLJ00032,HKr18,HZF5,KIAA1611,KR18
  • Gene Description:
  • zinc finger protein 160
  • Gene Summary:
  • The protein encoded by this gene is a Kruppel-related zinc finger protein which is characterized by the presence of an N-terminal repressor domain, the Kruppel-associated box (KRAB). The KRAB domain is a potent repressor of transcription; thus this protein may function in transcription regulation. Three alternative transcripts encoding the same protein have been described. [provided by RefSeq
  • Other Designations:
  • KRAB zinc finger protein KR18
  • RSS
  • YouTube
  • Linkedin
  • Facebook