ZNF160 monoclonal antibody (M04), clone 3B8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ZNF160 is 1 ng/ml as a capture antibody.
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant ZNF160.
Immunogen
ZNF160 (ENSP00000347273, 1 a.a. ~ 147 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MALTQVRLTFRDVAIEFSQEEWKCLDPAQRILYRDVMLENYWNLVSLGLCHFDMNIISMLEEGKEPWTVKSCVKIARKPRTPECVKGVVTDLLRRWKHWLLLLGICCPKPHGRVSSRLRLSRSLGHFFHSAFATFMGVCDKRVGSIF
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ZNF160 is 1 ng/ml as a capture antibody.ELISA
-
Gene Info — ZNF160
Entrez GeneID
90338GeneBank Accession#
ENST00000355147Protein Accession#
ENSP00000347273Gene Name
ZNF160
Gene Alias
DKFZp686B16128, F11, FLJ00032, HKr18, HZF5, KIAA1611, KR18
Gene Description
zinc finger protein 160
Omim ID
600398Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a Kruppel-related zinc finger protein which is characterized by the presence of an N-terminal repressor domain, the Kruppel-associated box (KRAB). The KRAB domain is a potent repressor of transcription; thus this protein may function in transcription regulation. Three alternative transcripts encoding the same protein have been described. [provided by RefSeq
Other Designations
KRAB zinc finger protein KR18
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com