Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SYS1 purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00090196-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human SYS1 protein.
  • Immunogen:
  • SYS1 (ACE87579.1, 1 a.a. ~ 156 a.a) full-length human protein.
  • Sequence:
  • MAGQFRSYVWDPLLILSQIVLMQTVYYGSLGLWLALVDGLVRSSPSLDQMFDAEILGFSTPPGRLSMMSFILNALTCALGLLYFIRRGKQCLDFTVTVHFFHLLGCWFYSSRFPSALTWWLVQAVCIALMAVIGEYLCMRTELKEIPLNSAPKSNV
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Application Image
  • Western Blot (Transfected lysate)
  • Gene Information
  • Gene Name:
  • SYS1
  • Gene Alias:
  • C20orf169,dJ453C12.4,dJ453C12.4.1
  • Gene Description:
  • SYS1 Golgi-localized integral membrane protein homolog (S. cerevisiae)
  • Gene Summary:
  • SYS1 forms a complex with ADP-ribosylation factor-related protein ARFRP1 (MIM 604699) and targets ARFRP1 to the Golgi apparatus (Behnia et al., 2004 [PubMed 15077113]).[supplied by OMIM
  • Other Designations:
  • OTTHUMP00000031125,OTTHUMP00000031129,SYS1 Golgi-localized integral membrane protein homolog
  • RSS
  • YouTube
  • Linkedin
  • Facebook