SIGLEC12 monoclonal antibody (M01), clone 1D1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SIGLEC12.
Immunogen
SIGLEC12 (NP_443729.1, 503 a.a. ~ 595 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
RSCRKKSARPAVGVGDTGMEDANAVRGSASQGPLIESPADDSPPHHAPPALATPSPEEGEIQYASLSFHKARPQYPQEQEAIGYEYSEINIPK
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.97 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of SIGLEC12 expression in transfected 293T cell line by SIGLEC12 monoclonal antibody (M01), clone 1D1.
Lane 1: SIGLEC12 transfected lysate (Predicted MW: 65 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SIGLEC12 is 0.3 ng/ml as a capture antibody.ELISA
-
Gene Info — SIGLEC12
Entrez GeneID
89858GeneBank Accession#
NM_053003Protein Accession#
NP_443729.1Gene Name
SIGLEC12
Gene Alias
FLJ38600, S2V, SIGLECL1, SLG, Siglec-12, Siglec-L1, Siglec-XII
Gene Description
sialic acid binding Ig-like lectin 12
Omim ID
606094Gene Ontology
HyperlinkGene Summary
Sialic acid-binding immunoglobulin-like lectins (SIGLECs) are a family of cell surface proteins belonging to the immunoglobulin superfamily. They mediate protein-carbohydrate interactions by selectively binding to different sialic acid moieties present on glycolipids and glycoproteins. This gene encodes a member of the SIGLEC3-like subfamily of SIGLECs. Members of this subfamily are characterized by an extracellular V-set immunoglobulin-like domain followed by two C2-set immunoglobulin-like domains, and the cytoplasmic tyrosine-based motifs ITIM and SLAM-like. The encoded protein, upon tyrosine phosphorylation, has been shown to recruit the Src homology 2 domain-containing protein-tyrosine phosphatases SHP1 and SHP2. It has been suggested that the protein is involved in the negative regulation of macrophage signaling by functioning as an inhibitory receptor. This gene is located in a cluster with other SIGLEC3-like genes on 19q13.4. Alternatively spliced transcript variants encoding distinct isoforms have been described for this gene. [provided by RefSeq
Other Designations
SIGLEC-like 1|sialic acid binding immunoglobulin-like lectin-like protein 1
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com