Product Browser

Last updated: 2017/1/15
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TSGA2 polyclonal antibody (A01)

  • Catalog # : H00089765-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant TSGA2.
  • Immunogen:
  • TSGA2 (NP_543136, 200 a.a. ~ 309 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • EELVTVVPKWKATQITELALWTPTLPKKPTSTDGPGQDAPGAESAGEPGEEAQALLEGFEGEMDMRPGDEDADVLREESREYDQEEFRYDMDEGNINSEEEETRQSDLQD
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00089765-A01
    Western Blot detection against Immunogen (38.21 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • TSGA2 polyclonal antibody (A01), Lot # 050921JC01 Western Blot analysis of TSGA2 expression in U-2 OS ( Cat # L022V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • RSPH1
  • Gene Alias:
  • MGC126568,MGC141927,RSP44,RSPH10A,TSA2,TSGA2
  • Gene Description:
  • radial spoke head 1 homolog (Chlamydomonas)
  • Other Designations:
  • h-meichroacidin,male meiotic metaphase chromosome-associated acidic protein,meichroacidin,testes specific A2 homolog,testes specific gene A2 homolog,testis specific A2 homolog,testis-specific gene A2
  • RSS
  • YouTube
  • Linkedin
  • Facebook