SELI polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
SELI polyclonal antibody (A01), Lot # 060529JCS1 Western Blot analysis of SELI expression in HeLa ( Cat # L013V1 ).
Western Blot detection against Immunogen (31.61 KDa) .
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant SELI.
Immunogen
SELI (NP_277040, 1 a.a. ~ 50 a.a) partial recombinant protein with GST tag.
Sequence
MAGYEYVSPEQLAGFDKYKYSAVDTNPLSLYVMHPFWNTIVKVFPTWLAP
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (94); Rat (98)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (31.61 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
SELI polyclonal antibody (A01), Lot # 060529JCS1 Western Blot analysis of SELI expression in HeLa ( Cat # L013V1 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — SELI
Entrez GeneID
85465GeneBank Accession#
NM_033505Protein Accession#
NP_277040Gene Name
SELI
Gene Alias
KIAA1724
Gene Description
selenoprotein I
Omim ID
607915Gene Ontology
HyperlinkGene Summary
This gene encodes a selenoprotein, which contains a selenocysteine (Sec) residue at its active site. The selenocysteine is encoded by the UGA codon that normally signals translation termination. The 3' UTR of selenoprotein genes have a common stem-loop structure, the sec insertion sequence (SECIS), that is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. [provided by RefSeq
Other Designations
-
-
Interactome
-
Disease
-
Publication Reference
-
Metabolic control of T FH cells and humoral immunity by phosphatidylethanolamine.
Guotong Fu, Clifford S Guy, Nicole M Chapman, Gustavo Palacios, Jun Wei, Peipei Zhou, Lingyun Long, Yong-Dong Wang, Chenxi Qian, Yogesh Dhungana, Hongling Huang, Anil Kc, Hao Shi, Sherri Rankin, Scott A Brown, Amanda Johnson, Randall Wakefield, Camenzind G Robinson, Xueyan Liu, Anthony Sheyn, Jiyang Yu, Suzanne Jackowski, Hongbo Chi.
Nature 2021 Jul; 595(7869):724.
Application：WB, Mouse, SMARTA cell.
-
Mutations in the selenocysteine insertion sequence-binding protein 2 gene lead to a multisystem selenoprotein deficiency disorder in humans.
Schoenmakers E, Agostini M, Mitchell C, Schoenmakers N, Papp L, Rajanayagam O, Padidela R, Ceron-Gutierrez L, Doffinger R, Prevosto C, Luan J, Montano S, Lu J, Castanet M, Clemons N, Groeneveld M, Castets P, Karbaschi M, Aitken S, Dixon A, Williams J, Campi I, Blount M, Burton H, Muntoni F, O'Donovan D, Dean A, Warren A, Brierley C, Baguley D, Guicheney P, Fitzgerald R, Coles A, Gaston H, Todd P, Holmgren A, Khanna KK, Cooke M, Semple R, Halsall D, Wareham N, Schwabe J, Grasso L, Beck-Peccoz P,.
The Journal of Clinical Investigation 2010 Dec; 120(12):4220.
Application：WB-Ce, Human, Fibroblasts.
-
Metabolic control of T FH cells and humoral immunity by phosphatidylethanolamine.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com